6SNWA

Structure of coxsackievirus a10 complexed with its receptor kremen1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
296
structure length
293
Chain Sequence
DPVEDIIHDALSSTVRTSGQDVNTAAGTAPSSHRLETGRVPALQAAETGATSNATDENMIETRCVMNRNGVLEATISHFFSRSGLVGVVNLTDGGTDTTGYAVWDIDIMGFVQLRRKCEMFTYMRFNAEFTFVTTTENGEARPFMLQYMYVPPGAPKPTGRDAFQWQTATNPSVFVKLTDPPAQVSVPFMSPASAYQWFYDGYPTFGQHPETSNTTYGQCPNNMMGTFAVRVVSRVASQLKLQTRVYMKLKHVRAWIPRPIRSQPYLLKNFPNYDSSKITYSARDRASIKQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Hand-foot-and-mouth disease virus receptor KREMEN1 binds the canyon of Coxsackie Virus A10
doi rcsb
source organism Homo sapiens
total genus 34
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2019-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...