6SS0HHH

Structure of the arginase-2-inhibitory human antigen-binding fragment fab c0021181
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
216
Chain Sequence
VQLLESGGGLVRPGGSLRLSCAASEFTFRYDYHVWVRQAPGKGLEWVSAISGSGGSTYYADSVKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLRADLGLYMDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterisation of a high-affinity monoclonal antibody C0021158 that inhibits Arginase 2 function via a novel non-competitive mechanism of action
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Fab C0021181 heavy chain (IgG1)
total genus 40
structure length 216
sequence length 220
chains with identical sequence III
ec nomenclature
pdb deposition date 2019-09-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...