6SUWA

Crystal structure of rhodospirillum rubrum rru_a0973 e31a variant
Total Genus 35

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
STHEPLEVLKEETVNRHRAIVSVMAELEAVDWYDQRVDASTDPELTAILAHNRDEEKEHAAMTLEWLRRNDAKWAEHLRTYLFTEGPITAA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (12-14)TVIII1 (8-11)AH1 (17-45)EMPTYAH3 (78-87)AH2 (49-76)Updating...
connected with : NaN
molecule tags Oxidoreductase
source organism Rhodospirillum rubrum (strain atcc 11170 / ath 1.1.1 / dsm 467 / lmg 4362 / ncib
publication title Dissecting the structural and functional roles of a putative metal entry site in encapsulated ferritins.
pubmed doi rcsb
molecule keywords Uncharacterized protein
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d
ec nomenclature
pdb deposition date 2019-09-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.