6T1KA

Streptavidin variants harbouring an artificial organocatalyst based cofactor
Total Genus 27

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
122
Chain Sequence
EAGITGTWYNQLGSTFIVTAGADGALTGTYESAAGKAESRYVLGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTAGQTEANGWASTLVGHDTFTKVKPS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (19-23)TIV1 (47-50)TI1 (23-26)S3 (38-44)EMPTYS2 (28-34)TIV2 (61-64)S4 (54-60)TI3 (81-84)S5 (71-81)TIV4 (99-102)S6 (84-97)S7 (103-112)3H1 (116-121)TIV3 (66-69)Updating...
connected with : NaN
molecule tags Biotin-binding protein
source organism Streptomyces avidinii
publication title An organocatalyst based artificial cofactor in designed streptavidin
rcsb
molecule keywords Streptavidin
total genus 27
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2019-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.