6T69A

Crystal structure of toxoplasma gondii morn1(v shape)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
KYEGDWVNGKMHGHGKYIYSDGGVYEGDWIDGKMHGKGTYVFPNGNVYEGEWAHDMKDGYGVLTYQNGEKYEGYWKQDKVHGKGTLTYTRGDKYIGDWMDAKKDGEGELIYANGDRFKGQWADDRANGFGVFTYANGNRYEGEWTDDKRHGRGVFYCAEDGSAYEGEFVGGRKEGNGILRLATGHQLEGTWSGGQLVRVTSFVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three MORN repeat proteins and a re-evaluation of the proposed lipid-binding properties of MORN repeats.
pubmed doi rcsb
molecule tags Structural protein
source organism Toxoplasma gondii veg
molecule keywords Membrane occupation and recognition nexus protein MORN1
total genus 58
structure length 205
sequence length 205
ec nomenclature ec 2.1.1.43: Transferred entry: 2.1.1.354.
pdb deposition date 2019-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02493 MORN MORN repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...