6T84A

Crystal structure of the mycobacterial trehalose monomycolate transport factor a, ttfa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
178
Chain Sequence
RRGLGRRRKSWAKSHGFDYEYESEDLLKRWKRGVMSTVGDVTAKNVVLGQIRGEAVFIFDIEEVATVIALHRKVGTNVVVDLRLKGLKEPRENDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMWNEQNWTLVAMPVTSNRAQWDEGLRTVRQFNDLLRVLPPVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Uncharacterized protein
publication title The crystal structure of the mycobacterial trehalose monomycolate transport factor A, TtfA, reveals an atypical fold.
pubmed doi rcsb
source organism Mycolicibacterium smegmatis mc2 155
total genus 52
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2019-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...