6TJ6A

T. gondii myosin a trimeric complex with elc1, calcium-free
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
PPRVREAFALFDTDGDGEISGRDLVLAIRSCGVSPTPDEIKALPMSMAWPDFEAWMSKKLASYNPEEELIKSFKAFDRSNDGTVSADELSQVMLALGELLSDEEVKAMIKEADPNGTGKIQYANFVKMLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural role of essential light chains in the apicomplexan glideosome.
pubmed doi rcsb
molecule keywords Calmodulin, putative
molecule tags Motor protein
source organism Toxoplasma gondii
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2019-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...