6TNEA

Crystal structure of receiver domain from hybrid histidine kinase ccka
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
109
Chain Sequence
AGRILFVEDEDAVRSVAARLLRARGYEVLEAADGEEALIIAEENAGTIDLLISDVIMPGIDGPTLLKKARGYLGTAPVMFISGYETGVTFLPKPIDIKTLAERVKQQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
source organism Caulobacter vibrioides
publication title Crystal structure of receiver domain from cyclic-di-GMP controlled hybrid histidine kinase
rcsb
molecule keywords Cell cycle histidine kinase CckA
total genus 37
structure length 109
sequence length 120
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2019-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...