6TOPB

Structure of the pore c-terminal domain, a protein of t9ss from porphyromonas gingivalis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
150
structure length
150
Chain Sequence
SSGVDLGTENLYFQSLQNIFYDFDKATLRPESMKSLDELIRILTDNPDIRIELGSHADRKGPDAYNLGLSDRRAKSVVDYLTSRGIAADRLTWKGYGKSVPKTVTAKIAERHDFLKEGDVLTEEFVAPLTEEQQSVCDQLNRRTEFRVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Type IX secretion system PorE C-terminal domain from Porphyromonas gingivalis in complex with a peptidoglycan fragment.
pubmed doi rcsb
molecule tags Protein binding
source organism Porphyromonas gingivalis jcvi sc001
molecule keywords OmpA family protein
total genus 54
structure length 150
sequence length 150
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2019-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...