6TT9AAA

Rtbl recombinant lectin from tepary bean
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
233
structure length
233
Chain Sequence
ANDISFNFQRFNETNLILQGDASVSSSGQLRLTNLNDNGEPTLSSLGRAFYSTPIQIWDSTTGAVASFATSFTFNIRVPNNAGPADGLAFALVPVGSKPKDRGGLLGLFDGSDSKAHTVAVEFDTLYNRDWDPRERHIGIDVNSIKSIKTTPWDFVNGEDAEVLITYDSSTKLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATSGISKGNVETNDLLSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Phytohemagglutinin
publication title Recombinant Lectin from Tepary Bean (Phaseolus acutifolius) with Specific Recognition for Cancer-Associated Glycans: Production, Structural Characterization, and Target Identification.
pubmed doi rcsb
source organism Phaseolus acutifolius
total genus 53
structure length 233
sequence length 233
chains with identical sequence BBB, CCC, DDD
ec nomenclature
pdb deposition date 2019-12-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...