6TYJA

Crystal structure of zinc-bound hemerythrin hhe cation binding domain-containing protein (soak): rv2633c homolog from mycobacterium kansasii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
162
structure length
162
Chain Sequence
MVNAYEVLKEHHVVIKGLGRKISEAPVNSEERHALFDELLIELDIHFRIEDDLYYPALSAATKLIAVAHAEHRQVIDQLSVLLRTPQSEPGYEDEWNSFKTVLEAHADEEERDMIPAPPEVKITDAELEELGEKMAARMEQYRGSALYKLRTKGRAALVRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of zinc-bound Hemerythrin HHE cation binding domain-containing protein (soak): Rv2633c homolog from Mycobacterium kansasii
rcsb
molecule tags Protein binding
source organism Mycobacterium kansasii
molecule keywords Hemerythrin HHE cation binding domain protein
total genus 70
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2019-08-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...