6U0EA

Neutron crystal structure of t4l m6ae
Total Genus 57
204060801001201401600102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
164
structure length
164
Chain Sequence
MNIFEALRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (3-11)AH5 (93-113)3H1 (159-161)EMPTYS1 (14-19)TI'1 (54-57)TI1 (20-23)AH8 (137-141)S2 (25-28)AH3 (60-80)S3 (31-34)AH2 (39-50)AH9 (143-155)AH4 (83-90)AH6 (115-123)AH7 (126-134)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Enterobacteria phage t4
publication title Solvent entry into cavities of T4 lysozyme
rcsb
molecule keywords Endolysin
total genus 57
structure length 164
sequence length 164
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2019-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.