6UHSA

Open-form crystal structure of chimera bt-hryr_12 from bacteroides thetaiotaomicron /human
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
180
Chain Sequence
YIPEPMDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDDIHKKHPCLVPYDELPEEEKEYDRNTAMNTIKMVKKLGFRIEKEENKLDYIPEPMDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYKHPCLVPYDELPEEEKEYDRNTAMNTIKMVKKLGFRIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open-form Crystal Structure of Chimera Bt-hRyR_12 from Bacteroides thetaiotaomicron /human
rcsb
molecule keywords Ryanodine receptor 1 chimera
molecule tags Metal transport
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
total genus 47
structure length 180
sequence length 212
ec nomenclature
pdb deposition date 2019-09-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...