6UKIX

Hhai endonuclease in complex with dna in space group p212121 (ph 6.0)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
258
Chain Sequence
MNWKEFEVFCVTYLNKTYGNKFAKKGESDSTTSDILFTGNNPFYIEAKMPHSQCGQFVLIPNRAEYKFDYSPKNKSEINPYTQKIMQFMSENFSEYANLSTKGKIIPLPESVFVNWIKEYYKSKSVKFFITSNGDFIIFPIEHFEHYFNVSCTYRIKKSGSRHLNSKSLPDFKQALDKKGISYTMRGLELHSDENIHDKRISGDDKDFLIKENNGAYHVKILSNTFNANVIFSISLKNNISLFILNEDRKAFEAAISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords HhaI Restriction Endonuclease
publication title Structure of HhaI endonuclease with cognate DNA at an atomic resolution of 1.0 Angstrom
rcsb
source organism Haemophilus parahaemolyticus
total genus 65
structure length 258
sequence length 258
chains with identical sequence Y
ec nomenclature
pdb deposition date 2019-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...