6URHC

Crystal structure of broadly neutralizing antibody ar3x in complex with hepatitis c virus envelope glycoprotein e2 ectodomain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
226
structure length
161
Chain Sequence
WHINRTALNCNDSLHTGFLAALFYTHKFNASGCPRQCGTIPASQVCGPVYCFTPSPVVVGTTDRFGAPTYTWGENETDVLILNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCCGSGPWLTPRCLVDYPYRLWHYPCTVNFTIFKVRMYVGGVEHRLNAACN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/immune system
molecule keywords HCV envelope glycoprotein E2
publication title An ultralong CDRH2 in HCV neutralizing antibody demonstrates structural plasticity of antibodies against E2 glycoprotein.
pubmed doi rcsb
source organism Hepacivirus c
total genus 33
structure length 161
sequence length 226
ec nomenclature
pdb deposition date 2019-10-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...