6URUA

Iachsnfr fluorescent acetylcholine sensor precursor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
516
structure length
500
Chain Sequence
TVVVGSINFTEQIIVANMVAEMIEAHTDLKVVRKLNLGGTNVNFEAIKRGGANNGIDIYVEYTGTGLVDILGFPEPNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFPPPPTTDPEKAYETVKKEYKDKWNIVWLKPLGFNNTYTLAVKDELAKQYNLKTFSDLAKISDKLILGATMEFLEKPDGYPGLQKVYNFKFKHTKSMDMGIRYTAIDNNEVQVIDAFATDGLLVSHKLKILEDDKHFFPPYYAAPIIRQDVLDKHPELKDVLNKLANQISDEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Fluorescent protein
molecule keywords iAChSnFR precursor
publication title iAChSnFR Fluorescent Acetylcholine Sensor precursor
rcsb
source organism Escherichia coli
total genus 154
structure length 500
sequence length 516
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...