6UU8FFF

E. coli mutant sigma-s transcription initiation complex with a 7-nt rna ("fresh" mutant crystal soaked with gtp, utp, and ctp for 30 minutes)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
277
structure length
268
Chain Sequence
RVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERGTAVDALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural Insights into Transcription Initiation from De Novo RNA Synthesis to Transitioning into Elongation.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 268
sequence length 277
ec nomenclature
pdb deposition date 2019-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
FFF PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
FFF PF04539 Sigma70_r3 Sigma-70 region 3
FFF PF04542 Sigma70_r2 Sigma-70 region 2
FFF PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...