6UXYB

Prmt5:mep50 complexed with allosteric inhibitor compound 8
Total Genus 73

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (30-36)TIV4 (70-73)S6 (93-98)TII'1 (20-23)S2 (42-47)TIV1 (24-27)TI'2 (63-66)TI'1 (37-40)S3 (56-61)TIV2 (61-64)S7 (103-108)S4 (75-79)TI'3 (64-67)TIV3 (66-69)TI'4 (69-72)TIV6 (89-92)S5 (83-89)TI'5 (109-112)S11 (151-153)TIV9 (153-156)TI'7 (154-157)S8 (115-120)TI'6 (134-137)S9 (128-133)TI1 (144-147)TIV8 (136-139)S12 (170-175)S14 (193-196)S13 (182-187)TI2 (187-190)S15 (215-220)S17 (236-241)TVIII1 (199-202)TI'10 (232-235)TIV11 (221-224)TIV12 (222-225)TIV14 (266-269)S21 (279-283)S18 (249-252)O1 (251-253)S19 (258-263)S20 (271-275)TI'12 (275-278)TI'13 (284-287)S22 (289-293)TIV15 (306-309)S23 (300-305)TIV5 (88-91)S10 (139-144)TIV10 (176-179)TI'8 (179-182)S16 (227-232)TIV13 (241-244)Updating...
connected with : NaN
molecule tags Transferase/transcription
source organism Homo sapiens
publication title Allosteric modulation of Protein Arginine Methyltransferase 5 (PRMT5)
doi rcsb
molecule keywords Protein arginine N-methyltransferase 5
total genus 73
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2019-11-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.