6V3AE

Cryo-em structure of the acinetobacter baumannii ribosome: 70s with e-site trna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
186
structure length
186
Chain Sequence
SEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L33
total genus 37
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2019-11-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...