6V4WA

The crystal structure of a beta-lactamase from chitinophaga pinensis dsm 2588
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
274
Chain Sequence
SAQDNNTRQKVNEIAATARGHVGVAMMSLENGDTMTLNGNDHFPMQSVFKVPLAIAVLDQVDKGKLSLDQVIHITKKELLPFTWSPIREKYPEGTDLKLREVLAYTVSQSDNNGCDILFNLVGGTAYVEQYIHGLGVDSMAIKANEERMASAWKVQYTNWSSPLATLQLLKGIHTGKYLSKASNDFLLKIMKETTTGPKRLRGMLPADAVVAHKTGSSDTKDGLTAATNDAGIVTLPDGSHLAIVVFVSDTKVNEAIREGVIARITRLFWDAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a beta-lactamase from Chitinophaga pinensis DSM 2588
rcsb
molecule tags Hydrolase
source organism Chitinophaga pinensis (strain atcc 43595 / dsm 2588 / ncib 11800 / uqm 2034)
molecule keywords Beta-lactamase
total genus 95
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...