6V6AA

Inhibitory scaffolding of the ancient mapk, erk7
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
317
Chain Sequence
EVDKHVLRKYDILQKLGKGAYGIVWKSTDRRTNETVALKKIFDAFQNATDAQRTFREIMFLQELAGHENIVRLKNVLKADNDKDIYLVFDYMETDLHAVIRADILEEIHKQYIVYQLLRAIKYMHSGELLHRDMKPSNVLLNSECQVKVADFGLARSVVATRWYRAPEILLGSTSYTKGVDMWSLGCILGELLSGRPIFPGTSTMNQLERIMTLTGRPSPEDVDAVKSPFAATMMESLPLGVKNFKDAFPNASPEALDLLKQLLQFNPNKRISAEKGLEHPYVRQFHSPEDEPVCGKIIAIVEDYRDKVYSEVIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Mitogen-activated protein kinase
publication title Ancient MAPK ERK7 is regulated by an unusual inhibitory scaffold required forToxoplasmaapical complex biogenesis.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 106
structure length 317
sequence length 346
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2019-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...