6V91A

Crystal structure of stringent starvation protein a (bth_i2974) from burkholderia thailandensis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRRGHHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Stringent starvation protein A
publication title Crystal structure of Stringent starvation protein A (BTH_I2974) from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis e264
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-12-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...