6VVTE

Crystal structure of a mycobacterium smegmatis transcription initiation complex with rifampicin-resistant rna polymerase and antibiotic sorangicin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
AYDTPLGITNPPIDELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEKPLSIALREIHGDLLEHTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/antibiotic
molecule keywords RNA polymerase-binding protein RbpA
publication title The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
pubmed doi rcsb
source organism Mycolicibacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 18
structure length 82
sequence length 82
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2020-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...