6VWNS

70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
96
Chain Sequence
AAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKHQKPPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA stem-loops can pause the ribosome by hindering A-site tRNA binding.
pubmed doi rcsb
molecule keywords 5S ribosomal RNA
molecule tags Ribosome
total genus 14
structure length 96
sequence length 102
ec nomenclature
pdb deposition date 2020-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00467 KOW KOW motif
S PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...