6VZJY

Escherichia coli transcription-translation complex a1 (ttc-a1) containing mrna with a 15 nt long spacer, fmet-trnas at e-site and p-site, and lacking transcription factor nusg
Total Genus 6

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (10-12)S2 (54-59)EMPTYTIV1 (13-16)TI1 (24-27)TIV4 (21-24)TIV12 (41-44)TIV9 (37-40)TI6 (42-45)TIV10 (38-41)TIV11 (39-42)TI12 (109-112)3H1 (75-77)TI7 (77-80)TI8 (101-104)AH1 (121-132)TIV23 (104-107)TI11 (108-111)TIV24 (105-108)TVIII2 (118-121)TI3 (33-36)TIV7 (35-38)S3 (67-69)TIV20 (85-88)TIV21 (87-90)TI13 (133-136)Updating...
connected with : NaN
molecule tags Ribosome
source organism Escherichia coli
publication title Structural basis of transcription-translation coupling.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L21
total genus 6
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2020-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Y PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.