6W09Q

Human mabs broadly protect against infection of arthritiogenic alphaviruses by recognizing conserved elements of the mxr8 receptor binding domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
PVMCLLANTTFPCSQPPCTPCCYEKEPEKTLRMLEDNVMSPGYYQLLQASLTCSPRRQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human mAbs Broadly Protect against Arthritogenic Alphaviruses by Recognizing Conserved Elements of the Mxra8 Receptor-Binding Site.
pubmed doi rcsb
molecule keywords E1 glycoprotein
molecule tags Virus/immune system
source organism Chikungunya virus
total genus 7
structure length 60
sequence length 60
chains with identical sequence R, S, T
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2020-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01563 Alpha_E3_glycop Alphavirus E3 glycoprotein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...