6W1XC

Cryo-em structure of anti-crispr acrif9, bound to the type i-f crrna-guided crispr surveillance complex
Total Genus 58

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
333
structure length
290
Chain Sequence
LSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTVIII7 (290-293)O1 (284-286)TIV8 (196-199)TIV2 (51-54)TVIII1 (28-31)TVIII4 (125-128)S2 (42-47)S6 (188-196)TIV7 (184-187)S5 (176-185)TVIII2 (52-55)TVIII6 (174-177)TII2 (171-174)TIV3 (65-99)TIV5 (164-167)S10 (267-268)TIV4 (66-100)TVIII3 (104-107)AH2 (150-162)S3 (109-118)AH3 (209-223)TI1 (121-124)AH1 (131-147)S4 (127-128)TVIII5 (128-131)TI2 (167-170)TI5 (201-204)S8 (248-249)S7 (228-237)TII3 (239-242)TIV9 (249-264)S11 (271-274)TIV10 (267-270)AH4 (276-284)TII1 (55-58)TIV1 (35-38)S1 (30-33)S9 (264-265)Updating...
connected with : NaN
molecule tags Immune system/rna
source organism Pseudomonas aeruginosa
publication title AcrIF9 tethers non-sequence specific dsDNA to the CRISPR RNA-guided surveillance complex.
pubmed doi rcsb
molecule keywords CRISPR-associated protein Csy1
total genus 58
structure length 290
sequence length 333
chains with identical sequence D, E, F, G, H
ec nomenclature
pdb deposition date 2020-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09615 Cas_Csy3 CRISPR-associated protein (Cas_Csy3)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.