6W1XI

Cryo-em structure of anti-crispr acrif9, bound to the type i-f crrna-guided crispr surveillance complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
STYIIKEVQNINSDREGVKVETTSLTSAKRIASKNQFFHGTVLRIESESGNWLAYKEDGKRWIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AcrIF9 tethers non-sequence specific dsDNA to the CRISPR RNA-guided surveillance complex.
pubmed doi rcsb
molecule keywords CRISPR-associated protein Csy1
molecule tags Immune system/rna
source organism Pseudomonas aeruginosa
total genus 10
structure length 64
sequence length 64
chains with identical sequence J
ec nomenclature
pdb deposition date 2020-03-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...