6W6WD

Cryo-em structure of cst bound to telomeric single-stranded dna
Total Genus 22

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
LPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYO1 (6-8)AH2 (102-117)AH1 (12-16)S4 (52-58)TII1 (21-24)S5 (71-81)TI1 (36-39)TIV3 (59-62)TI2 (37-40)S3 (41-47)TIV2 (48-51)TII2 (68-71)TI'1 (83-86)S1 (24-26)S2 (29-36)S6 (87-96)TIV6 (82-85)TIV8 (97-100)Updating...
connected with : NaN
molecule tags Structural protein/dna
source organism Homo sapiens
publication title The structure of human CST reveals a decameric assembly bound to telomeric DNA.
pubmed doi rcsb
molecule keywords CST complex subunit CTC1
total genus 22
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2020-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15490 Ten1_2 Telomere-capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.