6WC8A

Hiv integrase core domain in complex with inhibitor 2-(5-(3-fluorophenyl)-2-(2-(thiophen-2-yl)ethynyl)-1- benzofuran-3-yl)ethanoic acid
Total Genus 47

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRGGYSAGERIVDIIATDI

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI2 (78-81)TI1 (57-60)S1 (60-68)TIV1 (67-70)S2 (71-78)S3 (84-89)3H1 (119-121)S4 (112-115)AH2 (124-133)S5 (136-139)TI3 (79-82)TIV2 (89-92)AH1 (94-107)Updating...
connected with : NaN
molecule tags Transferase/transferase inhibitor
source organism Human immunodeficiency virus 1
publication title HIV Integrase core domain in complex with inhibitor
rcsb
molecule keywords Integrase
total genus 47
structure length 138
sequence length 152
ec nomenclature ec 2.7.7.-:
pdb deposition date 2020-03-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...