6WEEA

Copper-bound m88i variant of campylobacter jejuni p19
Total Genus 23

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPIVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS2 (15-22)S1 (4-12)TIV1 (11-14)S3 (41-49)TIV5 (50-53)S7 (93-100)TIV3 (29-32)TIV4 (31-34)3H1 (36-38)TIV6 (101-104)S4 (61-62)TII1 (58-61)S5 (67-74)TI3 (75-78)S8 (113-122)TI2 (74-77)TI6 (105-108)S6 (79-90)TI4 (90-93)S9 (146-154)TI1 (53-56)3H2 (125-127)TI7 (135-138)TIV8 (134-137)Updating...
connected with : NaN
molecule tags Transport protein
source organism Campylobacter jejuni subsp. jejuni serotype o:23/36 (strain 81-176)
publication title A copper site is required for iron transport by the periplasmic proteins P19 and FetP.
pubmed doi rcsb
molecule keywords Uncharacterized protein
total genus 23
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-04-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.