6WGC7

Atomic model of semi-attached mutant occm-dna complex (orc-cdc6-cdt1-mcm2-7 with mcm6 whd truncation)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
PTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication/dna
molecule keywords Cell division control protein 6
publication title Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 52
sequence length 52
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2020-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
7 PF00493 MCM MCM P-loop domain
7 PF14551 MCM_N MCM N-terminal domain
7 PF17207 MCM_OB MCM OB domain
7 PF17855 MCM_lid MCM AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...