6WH31

Capsid structure of penaeus monodon metallodensovirus at ph 8.2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
334
structure length
334
Chain Sequence
EGDGSAPGGSVWQTTDYIALSMVVYRTAIKLRNFVNIRGLTPTEMIVIPWNVMRFYCEYNTGTYGLSGNVHHKNYSMLLACKAHRPTKVGYTLSNLILTSDELVSTGGTLGTTTTFNTSPYMIHSIDDQQCLSKVYPKTDTVWPVSSMRELDYVASTVSGDNAIIPSTIFNKNRYWKQGDDALHFSHDLDLGFWFGSDYGNAYVPQNNDSMNAVGTIPTSKHINVRGVNNRGMAGHYLSFPPIRTNDGQFKLNAQFTLETEIEFEFRLWEQGVQGINSVHTNLNPANDSLWIQSYGSLVSITESKINNIQFGPTCPRVDARNKGGKMSMLFDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Penaeus monodon metallodensovirus major capsid protein
publication title Molecular biology and structure of a novel penaeid shrimp densovirus elucidate convergent parvoviral host capsid evolution
rcsb
source organism Penaeus monodon metallodensovirus
total genus 61
structure length 334
sequence length 334
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z
ec nomenclature
pdb deposition date 2020-04-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...