6WJEC

Copper resistance protein copg- form 2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
123
Chain Sequence
EPLAIDVHRDANCGCCKDWIKHLEANGFKVTDHVEADMSAVKSRLGVPYSMGSCHTGVIDGKFVEGHVPAADILKLRERADLVGAAVPGMPVGSPGMEGDRQDAYQVVGLTRSGQASVLAEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacterial copper-resistance protein CopG contains a cysteine-bridged tetranuclear copper cluster.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
molecule keywords DUF411 domain-containing protein
total genus 37
structure length 123
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...