6WMTB

F. tularensis rnaps70-(mgla-sspa)-ppgpp-pigr-igla dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
LENLLHPTNIKIDEYAKNATKFSFEALERGVGYTLGFALKQTMLYSIAGACVTSIKINDGKVTSLEDVIPCDETVADIILNVKSLSVTLAEDVETGTITFELSGSEEEIFSEEAKLSEGLAITEEVFICSYNGGKKLKIEAKVEKGVGFRPAQDNFKDGEFLLDATFSPVVFCDFEIKDARVGRRTDLDKLELNIKTNGNVNCEEALRLAATKIQNQLRNIVDIEEINKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Virulence Activation of Francisella tularensis.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha 2
molecule tags Transcription
total genus 39
structure length 230
sequence length 230
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2020-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
B PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...