6WSHA

Crystal structure of eutv from enterococcus faecalis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
190
structure length
190
Chain Sequence
NMDGRIVIVDDEPITRLDIRDIVIEAGYEVVGEAADGFEAIEVCKKTQPDLVLMDIQMPILDGLKAGKKIVQDQLASSIVFLSAYSDVQNTDKAKKLGALGYLVKPLDEKSLIPTIEMSIERGKQTQLLLSQIDKLSLKLEERKIIEKAKGILVKENHISEEEAYQMLRTLSMNKRARMSEIAELIVMDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Response regulator
publication title Structural characterisation of the E. faecalis anti-terminator protein EutV bound to RNA
rcsb
source organism Enterococcus faecalis
total genus 71
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...