6WSKA

Crystal structure of the cannabinoid receptor 1 interacting protein 1a (crip1a)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
329
structure length
287
Chain Sequence
GMNIFEMLRIDQRLRLKIYKYTIGIGHLLGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYAAHMGDLPGIVRLSIALRIQPNDGPVFFKRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKCRVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cannabinoid receptor interacting protein 1a interacts with myristoylated G alpha i N terminus via a unique gapped beta-barrel structure.
pubmed doi rcsb
molecule keywords Endolysin,CB1 cannabinoid receptor-interacting protein 1 fusion
molecule tags Signaling protein
source organism Enterobacteria phage t4
total genus 83
structure length 287
sequence length 329
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2020-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF15043 CNRIP1 CB1 cannabinoid receptor-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...