6WXQA

Crystal structure of crispr-associated transcription factor csa3 complexed with ca4
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
208
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cyclic oligoadenylate binding to the transcription factor Csa3 outlines cross talk between type III and type I CRISPR systems.
pubmed doi rcsb
molecule tags Transcription
source organism Saccharolobus solfataricus
molecule keywords CRISPR-associated transcription factor Csa3 (Type I-A)
total genus 66
structure length 208
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...