6X1IB

Two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
QLKKKLQALKKKNAQLKWKLQALKKKLAQATQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Cob_adeno_trans domain-containing protein PH0671 fused to a
publication title Geometric Lessons and Design Strategies for Nanoscale Protein Cages
rcsb
source organism Pyrococcus horikoshii (strain atcc 700860 / dsm 12428 / jcm 9974 / nbrc 100139 /
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2020-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...