6X23A

Pdz domain from choanoflagellate shank1 (mbshank1) bound to girk3 peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
89
Chain Sequence
APEGKMDLIIMRGDKGFGFRLSGATHAQGQWVRNVDPDGQAARAGLQAGDRLLELNGVDVSFWSHRKVVDEIKRSGDVVAFRIARRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization and computational analysis of PDZ domains in Monosiga brevicollis.
pubmed doi rcsb
molecule keywords mbSHANK1 protein
molecule tags Signaling protein
source organism Monosiga brevicollis
total genus 18
structure length 89
sequence length 95
ec nomenclature
pdb deposition date 2020-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...