6X49A

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with 7-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj649), a non-nucleoside inhibitor
Total Genus 142
100200300400500020406080100120140
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
554
structure length
547
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
100200300400500500400300200100
020406080100120140Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII1 (13-16)S2 (60-62)AH1 (28-44)TIV4 (137-140)S1 (47-49)S6 (142-146)TI1 (51-54)3H3 (122-127)TIV1 (62-72)AH2 (77-83)3H1 (97-99)S10 (232-235)S8 (186-191)TII'1 (183-186)S7 (178-183)TVIII1 (103-106)S4 (105-110)AH4 (195-212)TIV3 (111-114)3H2 (115-117)S5 (129-132)TII2 (150-153)AH3 (155-174)TI2 (175-178)S9 (227-229)TIV5 (224-227)TI3 (235-238)AH5 (254-268)TIV6 (228-231)TVIII4 (310-313)AH7 (297-310)S14 (347-355)TIV7 (268-271)TII3 (271-274)AH6 (276-281)S13 (336-344)TI4 (320-323)TI'2 (333-336)S12 (326-333)S15 (361-362)AH8 (364-383)TII4 (344-347)AH11 (500-508)O2 (417-419)AH9 (395-404)S16 (388-391)S17 (414-416)TIV11 (419-422)TII5 (434-437)S18 (438-446)TI5 (448-451)S20 (464-470)TIV12 (447-450)TI6 (459-462)S19 (452-459)AH10 (474-488)AH12 (516-527)TVIII5 (490-493)TVIII6 (528-531)S21 (492-497)TII6 (537-540)TIV14 (510-513)TIV15 (542-545)3H4 (135-137)TIV13 (469-472)S23 (530-535)S22 (512-513)TVIII3 (288-291)TVIII2 (249-252)S3 (73-75)Updating...
connected with : NaN
molecule tags Transferase, hydrolase/inhibitor
source organism Human immunodeficiency virus type 1 group m subtype b
publication title Structural Investigation of 2-Naphthyl Phenyl Ether Inhibitors Bound to WT and Y181C Reverse Transcriptase Highlights Key Features of the NNRTI Binding Site.
pubmed doi rcsb
molecule keywords Reverse transcriptase/ribonuclease H
total genus 142
structure length 547
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2020-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.