6X5NH

Crystal structure of a stabilized pan ene bimolecular triplex with a gc-clamped polya tail
Total Genus 37

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (6-10)S9 (95-102)S10 (112-115)S3 (21-28)EMPTYS11 (119-123)TII1 (16-19)S2 (14-15)S8 (81-86)TI1 (31-34)TIV1 (27-30)TIV7 (76-79)S5 (48-54)TI2 (32-35)S4 (36-42)3H1 (91-93)S6 (61-63)TII2 (43-46)TIV3 (56-59)TIV2 (55-58)TIV5 (67-70)TI3 (64-67)S7 (71-76)TI4 (77-80)TIV8 (86-89)TI5 (105-108)TIV9 (104-107)S12 (132-136)S13 (147-157)TIV11 (139-142)TIV13 (144-147)S16 (188-197)TIV12 (140-143)TI6 (183-186)S17 (206-212)S14 (163-166)TI8 (201-204)3H2 (167-169)TVIII1 (169-172)TII3 (172-175)S15 (175-182)3H3 (198-200)S18 (217-223)TI7 (200-203)TI9 (213-216)TIV4 (65-68)TII'1 (108-111)TIV15 (212-215)Updating...
connected with : NaN
molecule tags Immune system/rna
source organism Mus musculus
publication title Targeting the Nuclear Expression Element (ENE) Triple Helix of Kaposi Sarcoma Herpesvirus Polyadenylated Nuclear RNA, PAN.
rcsb
molecule keywords Light chain Fab BL-3 6
total genus 37
structure length 225
sequence length 225
chains with identical sequence h
ec nomenclature
pdb deposition date 2020-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.