6X6KAY

Cryo-em structure of the helicobacter pylori dcag3 omc
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
234
structure length
209
Chain Sequence
PVKQAFIGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Cag pathogenicity island protein
publication title Cryo-EM analysis of the Helicobacter pylori Cag type IV secretion system reveals an expanded core complex and unique species-specific components
rcsb
total genus 40
structure length 209
sequence length 234
chains with identical sequence BY, CY, DY, EY, FY, GY, HY, IY, JY, KY, LY, MY, NY
ec nomenclature
pdb deposition date 2020-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AY PF03743 TrbI Bacterial conjugation TrbI-like protein
AY PF07337 CagY_M DC-EC Repeat
AY PF14585 CagY_I CagY type 1 repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...