6X6QA

Peptide-bound structure of marinomonas primoryensis peptide-binding domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
505
structure length
505
Chain Sequence
ATAGTVTVNAITSDDTIDGIELGQTISISGKAVGGDISVGDVVKMTINNTEYSTTVKAGGIWMIAGVLGSDLAADSEFDVVVTSSDAAGNKVQSIGTSTHSVDLSAEANFSLAEGQQHVLTNLPEGFGFPDGTTEVVTNFGGTITLGDDGEYRYDAPVRDHGDAVSDKDSVTVTLEDGRTFTVNLDIQDSAPVAVDDQDSIVVQHEEFEVSEIAASWVSYTHGESVTTFDGTSDLGGVDNDSAKDQIRWGNPAESKQSGYGFIDNDSNLEGRFDLNQDISVGTFTHYNYPVYSGGAITSAEMSVEFSVLDHLGVSTPVTLTVNFDHNETPNTNDVNASRDIVTVQNTHVTFERDGDIYTVQIVGFREVGNPDGEVVTSIYTNENAATSYELVVRVVEGDGYSLPSTEGNIFDDNGLGADSLGADGSVTVVGVAVGAIVSSNESVGHSIEGQYGNLVLNSDGSYVYDVTASVSDIPAGATESFAYLIQDQDGSTSSANLSINVGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for a bacterial adhesins peptide-binding module
rcsb
molecule tags Protein binding
source organism Marinomonas primoryensis
molecule keywords Antifreeze protein
total genus 109
structure length 505
sequence length 505
ec nomenclature
pdb deposition date 2020-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...