6X8MA

Cryoem structure of the holo-srpi encapsulin complex from synechococcus elongatus pcc 7942
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
280
Chain Sequence
LALRDVAARQLANATKTVPQLRTITPRWLVRLLHWTPVEAGIYRVNQVKDAFVDYIDNPREYLLSAVNTVVDVHTRISDLYSNPHDQIREQLRLTIEIMKERQESELINSREYGLLNNVAPGQLVHTRNGAPTPDDLDELLIRVWKEPAFFLAHPQAIAAFGRECTRRGVPPATVSLFGSSFITWRGVPLIPSDKVPLENGKTKILLLRVGESRQGVVGLYQPNLPGEQGMGLSVRFMGINRKALASYLVSLYCSLAVLTDDALAVLDNVDVTQYHTYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Protein SrpI
publication title Discovery and characterization of a novel family of prokaryotic nanocompartments involved in sulfur metabolism
doi rcsb
source organism Synechococcus elongatus (strain pcc 7942 / fachb-805)
total genus 65
structure length 280
sequence length 298
ec nomenclature
pdb deposition date 2020-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...