6X9QR

Cryo-em structure of an escherichia coli coupled transcription-translation complex b3 (ttc-b3) containing an mrna with a 27 nt long spacer, transcription factors nusa and nusg, and fmet-trnas at p-site and e-site
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
121
Chain Sequence
ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of an Escherichia coli coupled transcription-translation complex B2 (TTC-B2) containing an mRNA with a 27 nt long spacer, transcription factors NusA and NusG, and fMet-tRNAs at P-site and E-site
rcsb
molecule tags Ribosome,transcription/translation
source organism Escherichia coli
molecule keywords 50S ribosomal protein L21
total genus 16
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2020-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...