6XCJH

Crystal structure of dh650 fab from a rhesus macaque in complex with hiv-1 gp120 core
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
QVQLVQSGAEVKKPGASVKLSCKASGYGFTIYSINWVRQAPGQGLEWMGWINPRNGRIGYAQKFQDRVTMTRDTSTSIAYMELGSLRYEDTAVYFCTRGQLELTASRFDKWGQGVPVTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope Glycoprotein gp120
publication title Recapitulation of HIV-1 Env-antibody coevolution in macaques leading to neutralization breadth.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 42
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2020-06-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...