6XHBA

Crystal structure of wild-type kras (gmppnp-bound) in complex with ras-binding domain (rbd) and cysteine-rich domain (crd) of raf1/craf (crystal form ii)
Total Genus 59
204060801001201401600102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (2-10)S2 (38-46)AH5 (152-167)AH2 (66-74)AH1 (16-25)TII1 (11-14)S3 (49-57)TIV4 (145-148)EMPTYTIV1 (45-48)TI1 (59-62)TVIII1 (106-109)S4 (77-83)TI2 (83-86)AH3 (87-104)TIV3 (120-123)AH4 (127-137)S5 (111-116)TI3 (117-120)S6 (141-143)TI4 (146-149)TII2 (149-152)Updating...
connected with : NaN
molecule tags Oncoprotein/transferase
source organism Homo sapiens
publication title Crystal Structure of wild-type KRAS (GMPPNP-bound) in complex with RAS-binding domain (RBD) and cysteine-rich domain (CRD) of RAF1/CRAF (crystal form II)
rcsb
molecule keywords GTPase KRas
total genus 59
structure length 166
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2020-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.