6XHX1Q

Crystal structure of the a2058-unmethylated thermus thermophilus 70s ribosome in complex with erythromycin and protein y (yfia) at 2.55a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structural basis of the Erm-mediated resistance to macrolide antibiotics
rcsb
source organism Escherichia coli (strain k12)
total genus 31
structure length 141
sequence length 141
chains with identical sequence 2Q
ec nomenclature
pdb deposition date 2020-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1Q PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...