6XN7J

Structure of the lactococcus lactis csm ntr crispr-cas complex
Total Genus 53

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
352
structure length
309
Chain Sequence
MKKTYRVTLTALGPIFIGGGEKLKKYEYIFDKQKKVAHMIDHTKFTKYLLEKNLLDDFTSRVNSHFDLYDYLVNKKGIVFMPLVKYSVPVAQFMNDLNTFVKDAFGRPYIPGSSLKGALRTAILNDLKEDTKENEVFAHLQVSDSETIDLENLKVYQKVDYSKTAKPLPLYRECLKPNTEITFTVSFDDEYLTLKKIQNALHKTYQHYYIKWLKGGKVGETLIKGVTFALDQPSQNQGEIIYIGGGAGFVSKTLHYKSKNRDQARNDSFDILKQLFRTTYSKMRSVPDNVPTGKHYLEMGKARIKLEEL
5010015020025030030025020015010050
01020304050Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S3 (37-40)TII1 (26-29)AH1 (42-50)TI2 (32-35)TI3 (68-71)EMPTYS4 (84-86)TIV9 (81-84)TIV2 (51-54)AH2 (54-63)TIV3 (64-67)TI4 (70-73)TIV6 (72-75)S7 (169-177)TI7 (152-155)TI6 (151-154)TIV11 (143-146)TIV10 (141-144)AH3 (128-140)TI10 (204-207)TI5 (119-122)TIV21 (255-258)S8 (181-191)TVIII1 (140-143)TIV13 (150-153)TIV15 (177-180)TI8 (153-156)S6 (157-159)TI9 (165-168)S9 (195-198)S10 (200-203)TI11 (205-208)AH4 (210-225)TVIII3 (260-263)TI12 (232-235)TI14 (258-261)TIV23 (263-266)TIV22 (259-262)TIV24 (271-274)S1 (3-11)TIV25 (307-310)AH6 (287-301)TIV1 (11-14)S11 (268-269)S5 (113-114)TIV16 (192-195)Updating...
connected with : NaN
molecule tags Rna binding protein/rna
source organism Lactococcus lactis subsp. lactis
publication title Structural and biochemical characterization of in vivo assembled Lactococcus lactis CRISPR-Csm complex.
pubmed doi rcsb
molecule keywords CRISPR-associated protein Cas10
total genus 53
structure length 309
sequence length 352
ec nomenclature
pdb deposition date 2020-07-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.